{"product_id":"proteintech-17607-1-ap","title":"Proteintech, 17607-1-AP, SLC39A9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A9 (17607-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A9 in WB, IHC, ELISA applications with reactivity to human samples\n17607-1-AP targets SLC39A9 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc transporter ZIP9 subfamily (SLC39A9) encodes a protein with characteristics of a membrane androgen receptor (mAR). Human ZIP9 is a 307-amino acid protein, which has eight putative transmembrane domains. ZIP9 has also been identified and characterized as a resident protein in the Golgi in DT40 and HeLa cell lines (PMID: 19420709, 23505453). ZIP9 may be present on the cell surface, as well as nuclear and mitochondrial membranes, in human breast and prostate cancer cell lines, where it mediates testosterone induction of apoptosis (PMID: 29952128). knockout of ZIP9 would lead to zinc accumulation in the secretory pathway, which could influence the general ion homeostasis and in turn the glycosylation outcome (PMID: 36648436).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11752 Product name: Recombinant human SLC39A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC047682 Sequence: MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNS Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 9\nCalculated Molecular Weight: 307 aa, 32 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC047682\nGene Symbol: SLC39A9\nGene ID (NCBI): 55334\nRRID: AB_3085528\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NUM3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806894249,"sku":"17607-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17607-1-ap","provider":"Iright","version":"1.0","type":"link"}