{"product_id":"proteintech-17642-1-ap","title":"Proteintech, 17642-1-AP, C7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C7 (17642-1-AP) by Proteintech is a Polyclonal antibody targeting C7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17642-1-AP targets C7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue,  human blood tissue\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). Complement component 7 (C7) is a single-chain plasma glycoprotein that is the final product of the complement cascade and plays a central role in the activation of the complement system. It is a constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells (PMID: 10886232; PMID: 27852032). C7 is a potential tumor suppressor and a prognostic biomarker for prostate cancer and renal cell carcinoma (PMID: 32984006; PMID: 33158953). C7 serves as a membrane anchor. People with C7 deficiency are prone to bacterial infection (PMID: 19758139).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11819 Product name: Recombinant human C7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-690 aa of BC063851 Sequence: GGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQ Predict reactive species\nFull Name: complement component 7\nCalculated Molecular Weight: 843 aa, 94 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC063851\nGene Symbol: C7\nGene ID (NCBI): 730\nRRID: AB_1959350\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10643\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869520351401,"sku":"17642-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17642-1-ap","provider":"Iright","version":"1.0","type":"link"}