{"product_id":"proteintech-17712-1-ap","title":"Proteintech, 17712-1-AP, ARFRP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARFRP1 (17712-1-AP) by Proteintech is a Polyclonal antibody targeting ARFRP1 in WB, IHC, ELISA applications with reactivity to human samples\n17712-1-AP targets ARFRP1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARFRP1, or ADP-ribosylation factor-related protein 1, is a small GTPase that is significantly similar to the ARF family of proteins. It plays a crucial role in intracellular membrane trafficking, particularly in post-Golgi membrane trafficking processes. ARFRP1 is primarily associated with the trans-Golgi compartment and the trans-Golgi network (TGN), where it functions as an essential regulatory factor for the targeting of Arl1 and GRIP domain-containing proteins, such as golgin-97 and golgin-245, onto Golgi membranes. Furthermore, ARFRP1 works in concert with Arl1 and GRIP proteins to facilitate the transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, as well as the retrograde transport of TGN38 and Shiga toxin from endosomes back to the TGN. This protein is also known to function upstream of ARL1 and ARL5, coordinating the recruitment of distinct tethering factors, golgins, and GARP, to the TGN. This mechanism is essential for the delivery of retrograde cargos to the TGN, making ARFRP1 a master regulator of retrograde-carrier tethering to the TGN.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12036 Product name: Recombinant human ARFRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC092480 Sequence: MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT Predict reactive species\nFull Name: ADP-ribosylation factor related protein 1\nCalculated Molecular Weight: 201 aa, 23 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC092480\nGene Symbol: ARFRP1\nGene ID (NCBI): 10139\nRRID: AB_2289839\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13795\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869638250665,"sku":"17712-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17712-1-ap","provider":"Iright","version":"1.0","type":"link"}