{"product_id":"proteintech-17728-1-ap","title":"Proteintech, 17728-1-AP, eIF4G2\/DAP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe eIF4G2\/DAP5 (17728-1-AP) by Proteintech is a Polyclonal antibody targeting eIF4G2\/DAP5 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n17728-1-AP targets eIF4G2\/DAP5 in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A172 cells, Jurkat cells,  MCF-7 cells,  U-87 MG cells,  Neuro-2a cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human prostate cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\neIF4G2, also commonly known as DAP5 (Death-Associated Protein 5) or p97, is a crucial and unique member of the eukaryotic translation initiation factor machinery. Unlike its canonical counterpart eIF4G1, which is central to the cap-dependent translation of most cellular mRNAs, eIF4G2\/DAP5 functions as a key regulator and facilitator of alternative, cap-independent translation under both normal and stress conditions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12125 Product name: Recombinant human EIF4G2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 563-907 aa of BC043149 Sequence: EAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD Predict reactive species\nFull Name: eukaryotic translation initiation factor 4 gamma, 2\nCalculated Molecular Weight: 907 aa, 102 kDa\nObserved Molecular Weight: 98-102 kDa\nGenBank Accession Number: BC043149\nGene Symbol: EIF4G2\nGene ID (NCBI): 1982\nRRID: AB_2095895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78344\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868979941545,"sku":"17728-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17728-1-ap","provider":"Iright","version":"1.0","type":"link"}