{"product_id":"proteintech-17731-1-ap","title":"Proteintech, 17731-1-AP, ENOPH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENOPH1 (17731-1-AP) by Proteintech is a Polyclonal antibody targeting ENOPH1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17731-1-AP targets ENOPH1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, K-562 cells,  L02 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA\/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12131 Product name: Recombinant human ENOPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC065815 Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST Predict reactive species\nFull Name: enolase-phosphatase 1\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: 29-35 kDa\nGenBank Accession Number: BC065815\nGene Symbol: ENOPH1\nGene ID (NCBI): 58478\nRRID: AB_2099471\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHY7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869678784681,"sku":"17731-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17731-1-ap","provider":"Iright","version":"1.0","type":"link"}