{"product_id":"proteintech-17779-1-ap","title":"Proteintech, 17779-1-AP, UCRC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UCRC (17779-1-AP) by Proteintech is a Polyclonal antibody targeting UCRC in WB, ELISA applications with reactivity to human, mouse, rat samples\n17779-1-AP targets UCRC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue,  human liver tissue,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10911 Product name: Recombinant human UCRC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC005402 Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK Predict reactive species\nFull Name: ubiquinol-cytochrome c reductase complex (7.2 kD)\nCalculated Molecular Weight: 63 aa, 7 kDa\nObserved Molecular Weight: 7 kDa\nGenBank Accession Number: BC005402\nGene Symbol: UCRC\nGene ID (NCBI): 29796\nRRID: AB_2035028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UDW1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869625209001,"sku":"17779-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17779-1-ap","provider":"Iright","version":"1.0","type":"link"}