{"product_id":"proteintech-17785-1-ap","title":"Proteintech, 17785-1-AP, Synaptophysin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Synaptophysin (17785-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptophysin in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n17785-1-AP targets Synaptophysin in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, PC-12 cells,  SH-SY5Y cells,  mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse pancreas tissue, mouse brain tissue,  human brain tissue,  ganglioma tissue,  human pancreas tissue,  neuroblastoma tissue,  human pituitary adenoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue, human lung cancer tissue,  human gliomas tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for the identification of neuroendocrine cells and neoplasms. Synaptic proteins, including synaptophysin, are reduced in brain tissue from patients with Alzheimer's disease. (PMID: 3010302; 21658579)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, canine, zebrafish, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11781 Product name: Recombinant human Synaptophysin; SYP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-313 aa of BC064550 Sequence: ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Predict reactive species\nFull Name: synaptophysin\nCalculated Molecular Weight: 313 aa, 34 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC064550\nGene Symbol: Synaptophysin\nGene ID (NCBI): 6855\nRRID: AB_2271365\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08247\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822130857,"sku":"17785-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17785-1-ap","provider":"Iright","version":"1.0","type":"link"}