{"product_id":"proteintech-17807-1-ap","title":"Proteintech, 17807-1-AP, SERP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SERP1 (17807-1-AP) by Proteintech is a Polyclonal antibody targeting SERP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17807-1-AP targets SERP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  HeLa cells,  mouse pancreas tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStress-associated endoplasmic reticulum (ER) protein 1 (SERP1), also known as ribosome- associated membrane protein 4 (RAMP4), is a Sec61-associated polypeptide that is induced by ER stress [PMID:16705175]. SERP1 interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It controls glycosylation of major histocompatibility complex class II-associated invariant chains by a translocational pausing mechanism, and its overexpression stabilizes newly synthesized membrane proteins under ER stress by associating with the Sec61 complex [PMID:10601334]. It is suggested SERP1 is involved in the biosynthesis\/processing of secretory proteins\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12087 Product name: Recombinant human SERP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-66 aa of BC108314 Sequence: MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM Predict reactive species\nFull Name: stress-associated endoplasmic reticulum protein 1\nCalculated Molecular Weight: 66 aa, 7 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC108314\nGene Symbol: SERP1\nGene ID (NCBI): 27230\nRRID: AB_10597394\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6X1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869384265897,"sku":"17807-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17807-1-ap","provider":"Iright","version":"1.0","type":"link"}