{"product_id":"proteintech-17815-1-ap","title":"Proteintech, 17815-1-AP, STX17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STX17 (17815-1-AP) by Proteintech is a Polyclonal antibody targeting STX17 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17815-1-AP targets STX17 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, L02 cells,  human testis tissue,  mouse testis tissue,  A375 cells,  rat testis tissue,  Jurkat cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for the fusion of cellular membranes. Syntaxin 17 (STX17) is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. STX17 may also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment\/ERGIC and Golgi and\/or regulate transport between the endoplasmic reticulum, the ERGIC, and the Golgi.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12134 Product name: Recombinant human STX17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC111009 Sequence: MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCGIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEE Predict reactive species\nFull Name: syntaxin 17\nCalculated Molecular Weight: 302 aa, 33 kDa\nObserved Molecular Weight: 33-38 kDa\nGenBank Accession Number: BC111009\nGene Symbol: STX17\nGene ID (NCBI): 55014\nRRID: AB_2255542\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56962\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839923881,"sku":"17815-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17815-1-ap","provider":"Iright","version":"1.0","type":"link"}