{"product_id":"proteintech-17835-1-ap","title":"Proteintech, 17835-1-AP, IL-3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-3 (17835-1-AP) by Proteintech is a Polyclonal antibody targeting IL-3 in WB, IHC, ELISA applications with reactivity to human samples\n17835-1-AP targets IL-3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein, Recombinant protein protein\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-3 (IL-3) is a multilineage hematopoietic growth factor that promotes the proliferation, differentiation and survival of early multilineage hematopoietic progenitors. In particular, this cytokine plays a key role in stimulating the proliferation and survival of myeloid precursors. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders (PMID: 24103757;2698876;2809196)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11839 Product name: Recombinant human IL-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-152 aa of BC066273 Sequence: GLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF Predict reactive species\nFull Name: interleukin 3 (colony-stimulating factor, multiple)\nCalculated Molecular Weight: 152 aa, 17 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC066273\nGene Symbol: IL-3\nGene ID (NCBI): 3562\nRRID: AB_10644127\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08700\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869697757353,"sku":"17835-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17835-1-ap","provider":"Iright","version":"1.0","type":"link"}