{"product_id":"proteintech-17876-1-ap","title":"Proteintech, 17876-1-AP, SLC6A18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC6A18 (17876-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A18 in WB, ELISA applications with reactivity to human, mouse samples\n17876-1-AP targets SLC6A18 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, RAW 264.7 cells,  mouse brain tissue,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC6A18, also known as XTRP2 and B0AT3, belongs to the SLC6 family of proteins. SLC6A18 acts as specific transporters for neurotransmitters, amino acids and osmolytes such as betaine, taurine and creatine. SLC6A18 is highly expressed at the luminal membrane of kidney proximal tubules and displays 50% identity with SLC6A19 (B0AT1), which is the main neutral amino acid transporter in both kidney and small intestine (PMID: 19478081, PMID: 21420947).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11685 Product name: Recombinant human SLC6A18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 224-413 aa of BC056757 Sequence: LIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTL Predict reactive species\nFull Name: solute carrier family 6, member 18\nCalculated Molecular Weight: 628 aa, 71 kDa\nObserved Molecular Weight: ~70 kDa\nGenBank Accession Number: BC056757\nGene Symbol: SLC6A18\nGene ID (NCBI): 348932\nRRID: AB_3085543\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96N87\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887807615145,"sku":"17876-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17876-1-ap","provider":"Iright","version":"1.0","type":"link"}