{"product_id":"proteintech-17880-1-ap","title":"Proteintech, 17880-1-AP, CAMSAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAMSAP2 (17880-1-AP) by Proteintech is a Polyclonal antibody targeting CAMSAP2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17880-1-AP targets CAMSAP2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse brain tissue,  PC-3 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human kidney tissue, human heart tissue,  human skin tissue,  human placenta tissue,  human ovary tissue,  human spleen tissue,  mouse testis tissue,  human testis tissue,  human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCAMSAP2, also known as CAMSAP1L1, is a microtubule minus-end binding protein, and is required for proper microtubule organization in neurons. CAMSAP2 stabilizes noncentrosomal microtubules and is important for neuronal polarity, axon specification, and dendritic branch formation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11794 Product name: Recombinant human CAMSAP1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 551-904 aa of BC065508 Sequence: KADVPVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVVKQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA Predict reactive species\nFull Name: calmodulin regulated spectrin-associated protein 1-like 1\nCalculated Molecular Weight: 1478 aa, 167 kDa\nObserved Molecular Weight: 168 kDa\nGenBank Accession Number: BC065508\nGene Symbol: CAMSAP2\nGene ID (NCBI): 23271\nRRID: AB_2068826\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08AD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842021033,"sku":"17880-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17880-1-ap","provider":"Iright","version":"1.0","type":"link"}