{"product_id":"proteintech-17917-1-ap","title":"Proteintech, 17917-1-AP, EIF4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF4B (17917-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n17917-1-AP targets EIF4B in WB, IHC, IF\/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, sodium arsenite treated HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF4B is one of the mammalian eukaryotic initiation factors (eIF) that are required for the ATP-dependent binding of mRNA to the 40 S ribosomal subunit, and the other eIF proteins are EIF4A, EIF4F. eIF4B is involved in translation of numerous proliferative or anti-apoptotic mRNAs with highly structured 5'UTR and subsequently affect cell growth and survival. It was reported that false expression and phosphorylation levels of eIF4B are involved in several tumors including breast cancer, cell lymphoblastic leukemia and diffuse large B-cell lymphoma (PMID: 26848623).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12325 Product name: Recombinant human EIF4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC073154 Sequence: MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS Predict reactive species\nFull Name: eukaryotic translation initiation factor 4B\nCalculated Molecular Weight: 611 aa, 69 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC073154\nGene Symbol: EIF4B\nGene ID (NCBI): 1975\nRRID: AB_2097541\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23588\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868917125289,"sku":"17917-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17917-1-ap","provider":"Iright","version":"1.0","type":"link"}