{"product_id":"proteintech-17923-1-ap","title":"Proteintech, 17923-1-AP, DEFA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DEFA6 (17923-1-AP) by Proteintech is a Polyclonal antibody targeting DEFA6 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n17923-1-AP targets DEFA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, mouse small intestine tissue\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDefensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. DEFA6 is alpha 6 of Defensin. This protein is secret expression and can be cleaved in to the fragments with MW 4-6 kDa. It can be used as a maker of Paneth cell. DEFA6 has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. it may protect cells against infection with HIV-1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12341 Product name: Recombinant human DEFA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-100 aa of BC093951 Sequence: AEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL Predict reactive species\nFull Name: defensin, alpha 6, Paneth cell-specific\nCalculated Molecular Weight: 100 aa, 11 kDa\nObserved Molecular Weight: 6-10 kDa\nGenBank Accession Number: BC093951\nGene Symbol: DEFA6\nGene ID (NCBI): 1671\nRRID: AB_2878468\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01524\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869456388265,"sku":"17923-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17923-1-ap","provider":"Iright","version":"1.0","type":"link"}