{"product_id":"proteintech-17926-1-ap","title":"Proteintech, 17926-1-AP, SFRS9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFRS9 (17926-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17926-1-AP targets SFRS9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: mouse kidney tissue, human cervical cancer tissue,  human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFRS9 is a member of the serine\/arginine (SR) splicing factor family, which contains an N-terminal RNA recognition motif (RRM), a glycine-rich region, an internal region homologous to the RRM, and a long (315-amino-acid) C-terminal domain composed predominantly of alternating serine and arginine residues. SRSF9 has been linked to the occurrence and progression of hepatocellular carcinoma (HCC), colorectal cancer (CRC) and oral squamous cell carcinoma (OSCC). In HCC and CRC, the knockdown of SRSF9  inhibited the proliferation and migration of cancer cells, cell cycle progression and colony formation of cancer cells (PMID: 34336668,35971121).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12347 Product name: Recombinant human SFRS9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC093973 Sequence: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 9\nCalculated Molecular Weight: 221 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC093973\nGene Symbol: SFRS9\nGene ID (NCBI): 8683\nRRID: AB_2270087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13242\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868945207465,"sku":"17926-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17926-1-ap","provider":"Iright","version":"1.0","type":"link"}