{"product_id":"proteintech-17946-1-ap","title":"Proteintech, 17946-1-AP, MRGPRX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRGPRX3 (17946-1-AP) by Proteintech is a Polyclonal antibody targeting MRGPRX3 in IHC, ELISA applications with reactivity to human, rat samples\n17946-1-AP targets MRGPRX3 in IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRGPRX3 (Mas-related G-protein coupled receptor member X3) is a member of the mas-related\/sensory neuron specific subfamily of G protein coupled receptors. MRGPRX3 may be involved in sensory neuron regulation and in the modulation of pain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12417 Product name: Recombinant human MRGPRX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-322 aa of BC067292 Sequence: SRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGQLPQETLELSGSRLEQ Predict reactive species\nFull Name: MAS-related GPR, member X3\nCalculated Molecular Weight: 322 aa, 36 kDa\nGenBank Accession Number: BC067292\nGene Symbol: MRGPRX3\nGene ID (NCBI): 117195\nRRID: AB_3669284\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96LB0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887724122281,"sku":"17946-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17946-1-ap","provider":"Iright","version":"1.0","type":"link"}