{"product_id":"proteintech-17955-1-ap","title":"Proteintech, 17955-1-AP, SRR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRR (17955-1-AP) by Proteintech is a Polyclonal antibody targeting SRR in WB, IP, IHC, ELISA applications with reactivity to human,   mouse,  rat samples\n17955-1-AP targets SRR in WB, IHC, IP, ELISA applications and shows reactivity with human,   mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSRR(serine racemase) is a 37 kDa protein and belongs to the serine\/threonine dehydratase family. It plays a role in neuronal activity and a potential biological role in the regulation of N-methyl-D-aspartate (NMDA) receptor activity in these peripheral organs as well. SRR catalyzes the racemization between l- and d-serine.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12449 Product name: Recombinant human SRR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC074728 Sequence: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV Predict reactive species\nFull Name: serine racemase\nCalculated Molecular Weight: 340 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC074728\nGene Symbol: SRR\nGene ID (NCBI): 63826\nRRID: AB_2878471\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZT4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869605122217,"sku":"17955-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17955-1-ap","provider":"Iright","version":"1.0","type":"link"}