{"product_id":"proteintech-18017-1-ap","title":"Proteintech, 18017-1-AP, BOLA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BOLA1 (18017-1-AP) by Proteintech is a Polyclonal antibody targeting BOLA1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18017-1-AP targets BOLA1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human lung tissue, human heart tissue,  human kidney tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12565 Product name: Recombinant human BOLA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-137 aa of BC063405 Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP Predict reactive species\nFull Name: bolA homolog 1 (E. coli)\nCalculated Molecular Weight: 137 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC063405\nGene Symbol: BOLA1\nGene ID (NCBI): 51027\nRRID: AB_2066933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3E2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869518680233,"sku":"18017-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18017-1-ap","provider":"Iright","version":"1.0","type":"link"}