{"product_id":"proteintech-18051-1-ap","title":"Proteintech, 18051-1-AP, DNA Ligase I Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNA Ligase I (18051-1-AP) by Proteintech is a Polyclonal antibody targeting DNA Ligase I in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18051-1-AP targets DNA Ligase I in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  Jurkat cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human spleen tissue,  human brain tissue,  human placenta tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA ligase I (LIG1) joins DNA strand breaks during DNA replication and repair transactions and contributes to genome integrity. 18051-1-AP is raised agains the C-terminal 670-919 aa residues of the  human DNA ligase 1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12508 Product name: Recombinant human LIG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 670-919 aa of BC108318 Sequence: LVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY Predict reactive species\nFull Name: ligase I, DNA, ATP-dependent\nCalculated Molecular Weight: 919 aa, 102 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC108318\nGene Symbol: LIG1\nGene ID (NCBI): 3978\nRRID: AB_2265726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18858\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893434025,"sku":"18051-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18051-1-ap","provider":"Iright","version":"1.0","type":"link"}