{"product_id":"proteintech-18064-1-ap","title":"Proteintech, 18064-1-AP, Histone H3.4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H3\n18064-1-AP targets Histone H3.4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse brain tissue,  mouse testis tissue\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHIST3H3, also known as H3.1t and H3.4, is a histone H3 protein variant that bears the H3.1 variant hallmark cysteine 96 but includes three extra amino acid substitutions. H3.1t was found to be expressed in primary human spermatocytes at the pachytene stage, similar to the human testis-specific histone H1t variant, where it appears therefore to take part in the process of spermatogenesis (PMID: 21782046).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12671 Product name: Recombinant human HIST3H3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC101837 Sequence: MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA Predict reactive species\nFull Name: histone cluster 3, H3\nCalculated Molecular Weight: 136 aa, 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC101837\nGene Symbol: Histone H3.4\nGene ID (NCBI): 8290\nRRID: AB_3669290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16695\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887668416681,"sku":"18064-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18064-1-ap","provider":"Iright","version":"1.0","type":"link"}