{"product_id":"proteintech-18074-1-ap","title":"Proteintech, 18074-1-AP, G6PC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe G6PC2 (18074-1-AP) by Proteintech is a Polyclonal antibody targeting G6PC2 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n18074-1-AP targets G6PC2 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse pancreas tissue\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG6PC2, also known as IGRP, is a member of the glucose-6-phosphatase catalytic subunit (G6PC) gene family. G6PC2 catalyzes the hydrolysis of glucose-6-phosphate to glucose and inorganic phosphate within the lumen of the endoplasmic reticulum. G6PC2 is mainly expressed in pancreatic islet β-cells. G6PC2 acts to oppose the action of the beta cell glucose sensor, glucokinase, by creating a futile substrate cycle. (PMID: 37855366, PMID: 32569842, PMID: 37552875)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12764 Product name: Recombinant human G6PC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC104778 Sequence: MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDKFSITLHRLTWS Predict reactive species\nFull Name: glucose-6-phosphatase, catalytic, 2\nCalculated Molecular Weight: 355 aa, 41 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC104778\nGene Symbol: G6PC2\nGene ID (NCBI): 57818\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQR9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887645151401,"sku":"18074-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18074-1-ap","provider":"Iright","version":"1.0","type":"link"}