{"product_id":"proteintech-18093-1-ap","title":"Proteintech, 18093-1-AP, Histone H1.5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H1\n18093-1-AP targets Histone H1.5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  LnCaP cells\nPositive IHC detected in: mouse brain tissue, human colon tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:30000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Histone H1.5, also known as Histone Cluster 1 H1 Family Member B (HIST1H1B), is a member of the Histone H1\/H5 protein family. Histone H1.5 gene has been found to be frequently mutated in colorectal cancer and follicular lymphomas. HIST1H1B overexpression contributes to tumor aggressiveness. Histone H1.5 expression is upregulated in breast cancer and predicts poor prognosis(PMID: 34746019).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12818 Product name: Recombinant human HIST1H1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC101581 Sequence: MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK Predict reactive species\nFull Name: histone cluster 1, H1b\nCalculated Molecular Weight: 226 aa, 23 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC101581\nGene Symbol: HIST1H1B\nGene ID (NCBI): 3009\nRRID: AB_3085553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16401\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887668220073,"sku":"18093-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18093-1-ap","provider":"Iright","version":"1.0","type":"link"}