{"product_id":"proteintech-18130-1-ap","title":"Proteintech, 18130-1-AP, LC8\/DYNLL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LC8\/DYNLL1 (18130-1-AP) by Proteintech is a Polyclonal antibody targeting LC8\/DYNLL1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n18130-1-AP targets LC8\/DYNLL1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  MCF-7 cells,  mouse brain tissue,  mouse cerebellum tissue,  mouse testis tissue\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: mouse brain tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLC8 (also known as DYNLL1) is a homodimeric sequence-specific chaperone that promotes the ordered (typically homo-) oligomerization of more than a hundred protein targets. LC8\/DYNLL1 has previously been proposed to function as an inhibitor of the NF-κB pathway, based on findings that it can bind directly to the IκBα regulatory region(PMID: 18579519). LC8\/DYNLL1 regulates apoptotic activities of BCL2L11 by sequestering it to microtubules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12710 Product name: Recombinant human LC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC100289 Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG Predict reactive species\nFull Name: dynein, light chain, LC8-type 1\nCalculated Molecular Weight: 89 aa, 10 kDa\nObserved Molecular Weight: 8-10 kDa\nGenBank Accession Number: BC100289\nGene Symbol: DYNLL1\nGene ID (NCBI): 8655\nRRID: AB_2923569\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63167\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869554561193,"sku":"18130-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18130-1-ap","provider":"Iright","version":"1.0","type":"link"}