{"product_id":"proteintech-18131-1-ap","title":"Proteintech, 18131-1-AP, Kindlin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Kindlin 3 (18131-1-AP) by Proteintech is a Polyclonal antibody targeting Kindlin 3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n18131-1-AP targets Kindlin 3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: J774A.1 cells, Jurkat cells,  Raji cells,  THP-1 cells,  mouse kidney tissue,  rat kidney tissue,  K-562 cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells, Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKindlin-3 (FERMT-3) is known to be central in hemostasis and thrombosis control and its deficiency disrupts platelet aggregation and causes Leukocyte Adhesion Deficiency disease. Point mutations in the kindlin-3 gene have been identified in humans with a rare inherited Integrin Activation efficiency Disease (IADD), also designated as Leukocyte Adhesion Deficiency syndrome (LAD-III or LADI variant). Kindlin-3 expression is restricted to cells of hematopoietic origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12713 Product name: Recombinant human FERMT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 321-663 aa of BC004347 Sequence: DDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF Predict reactive species\nFull Name: fermitin family homolog 3 (Drosophila)\nCalculated Molecular Weight: 76 kDa\nObserved Molecular Weight: 72-76 kDa\nGenBank Accession Number: BC004347\nGene Symbol: Kindlin 3\/FERMT3\nGene ID (NCBI): 83706\nRRID: AB_2103056\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UX7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869701263529,"sku":"18131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18131-1-ap","provider":"Iright","version":"1.0","type":"link"}