{"product_id":"proteintech-18151-1-ap","title":"Proteintech, 18151-1-AP, PDE6G\/H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDE6G\/H (18151-1-AP) by Proteintech is a Polyclonal antibody targeting PDE6G\/H in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n18151-1-AP targets PDE6G\/H in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, rat retina tissue\nPositive IP detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12847 Product name: Recombinant human PDE6H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC093738 Sequence: MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII Predict reactive species\nFull Name: phosphodiesterase 6H, cGMP-specific, cone, gamma\nCalculated Molecular Weight: 83 aa, 9 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC093738\nGene Symbol: PDE6H\nGene ID (NCBI): 5149\nRRID: AB_2878509\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13956\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869570912425,"sku":"18151-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18151-1-ap","provider":"Iright","version":"1.0","type":"link"}