{"product_id":"proteintech-18158-1-ap","title":"Proteintech, 18158-1-AP, MYL6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL6 (18158-1-AP) by Proteintech is a Polyclonal antibody targeting MYL6 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n18158-1-AP targets MYL6 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse uterus tissue, rat uterus tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, PubMed:2304459, PMID:2722814).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12964 Product name: Recombinant human MYL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC006781 Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG Predict reactive species\nFull Name: myosin, light chain 6, alkali, smooth muscle and non-muscle\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC006781\nGene Symbol: MYL6\nGene ID (NCBI): 4637\nRRID: AB_3085557\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60660\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887730479273,"sku":"18158-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18158-1-ap","provider":"Iright","version":"1.0","type":"link"}