{"product_id":"proteintech-18175-1-ap","title":"Proteintech, 18175-1-AP, Frizzled 10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Frizzled 10 (18175-1-AP) by Proteintech is a Polyclonal antibody targeting Frizzled 10 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n18175-1-AP targets Frizzled 10 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFZD10 (Frizzled homolog 10) is a member of the frizzled gene family, and considered as a seven-transmembrane Wnt-signaling receptor. FZD10 is expressed at high levels on the cell surface of almost all synovial sarcoma tissues but absent in most normal organs except for placenta. Up-regulation of FZD10 mRNA in several types of human cells might lead to carcinogenesis through activation of the beta-catenin-TCF signaling pathway with some class of WNTs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken, zebrafish, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12867 Product name: Recombinant human FZD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-229 aa of BC074998 Sequence: SMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVV Predict reactive species\nFull Name: frizzled homolog 10 (Drosophila)\nCalculated Molecular Weight: 581 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC074998\nGene Symbol: Frizzled 10\nGene ID (NCBI): 11211\nRRID: AB_2108942\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULW2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868941242537,"sku":"18175-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18175-1-ap","provider":"Iright","version":"1.0","type":"link"}