{"product_id":"proteintech-18181-1-ap","title":"Proteintech, 18181-1-AP, NOP56 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOP56 (18181-1-AP) by Proteintech is a Polyclonal antibody targeting NOP56 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n18181-1-AP targets NOP56 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, A549 cells,  HeLa cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBox C\/D RNA-protein complexes (RNPs) guide the 2'-O-methylation of nucleotides in eukaryotic ribosomal RNAs. The box C\/D and C'\/D' RNP subcomplexes are each assembled with three sRNP core proteins. The Nop56 core protein mediates crucial protein-protein interactions required for both sRNP assembly and the methyltransferase reaction by bridging the L7Ae and fibrillarin core proteins [PMID:22496443]. NOP56 is a component of the box C\/D small nucleolar ribonucleoprotein complexes that direct 2-prime-O-methylation of pre-ribosomal RNA (rRNA) during its maturation. It is predicted to function in an early to middle step in pre-rRNA processing [PMID:12777385].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12882 Product name: Recombinant human NOP56 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-594 aa of BC104791 Sequence: DASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED Predict reactive species\nFull Name: NOP56 ribonucleoprotein homolog (yeast)\nCalculated Molecular Weight: 594 aa, 66 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC104791\nGene Symbol: NOP56\nGene ID (NCBI): 10528\nRRID: AB_2152323\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00567\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869567406249,"sku":"18181-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18181-1-ap","provider":"Iright","version":"1.0","type":"link"}