{"product_id":"proteintech-18189-1-ap","title":"Proteintech, 18189-1-AP, Mast Cell Chymase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mast Cell Chymase (18189-1-AP) by Proteintech is a Polyclonal antibody targeting Mast Cell Chymase in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n18189-1-AP targets Mast Cell Chymase in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue,  human heart tissue,  human placenta tissue,  MCF-7 cells\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMast Cell Chymase, also named as CYH, CYM and CMA1, belongs to the peptidase S1 family and Granzyme subfamily. It is the major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. CMA1 maybe a target for cardiovascular disease therapies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12909 Product name: Recombinant human CMA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC069370 Sequence: MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN Predict reactive species\nFull Name: chymase 1, mast cell\nCalculated Molecular Weight: 247 aa, 27 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC069370\nGene Symbol: Mast Cell Chymase\nGene ID (NCBI): 1215\nRRID: AB_2083611\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23946\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868898152617,"sku":"18189-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18189-1-ap","provider":"Iright","version":"1.0","type":"link"}