{"product_id":"proteintech-18203-1-ap","title":"Proteintech, 18203-1-AP, PPM1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPM1L (18203-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18203-1-AP targets PPM1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\nPositive IHC detected in: human kidney tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPM1L(Protein phosphatase 1L) is also named as PP2CE.It belongs to the PP2C group of serine\/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. It has 4 isoforms produced by alternative splicing.This antibody is specific to PPM1L.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12775 Product name: Recombinant human PPM1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC104885 Sequence: MPAFSTTAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ Predict reactive species\nFull Name: protein phosphatase 1 (formerly 2C)-like\nCalculated Molecular Weight: 26 kDa, 41 kDa\nObserved Molecular Weight: 41-45 kDa\nGenBank Accession Number: BC104885\nGene Symbol: PPM1L\nGene ID (NCBI): 151742\nRRID: AB_10859821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5SGD2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869734457513,"sku":"18203-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18203-1-ap","provider":"Iright","version":"1.0","type":"link"}