{"product_id":"proteintech-18214-1-ap","title":"Proteintech, 18214-1-AP, CCL28 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL28 (18214-1-AP) by Proteintech is a Polyclonal antibody targeting CCL28 in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n18214-1-AP targets CCL28 in WB, IHC, IF, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human spleen tissue,  Jurkat cells,  mouse spleen tissue,  PC-3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL28, also named as SCYA28, CCK1 and MEC, belongs to the intercrine beta (chemokine CC) family. It has chemotactic activity for resting CD4, CD8 T-cells and eosinophils. CCL28 binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCL28 is expressed in a variety of human and mouse tissues, and it appears to be predominantly produced by epithelial cells. It is produced by epithelial cells of these tissues suggesting that this chemokine can play an important role by linking homing mechanisms between the gut, nasal mucosa and mammary gland (MG). In WB test, CCL28 is 14kd and 8-9kd(a putatively to a degradation fragment).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12920 Product name: Recombinant human CCL28 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-127 aa of BC069532 Sequence: MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY Predict reactive species\nFull Name: chemokine (C-C motif) ligand 28\nCalculated Molecular Weight: 127 aa, 14 kDa\nObserved Molecular Weight: 8 kDa-9 kDa\nGenBank Accession Number: BC069532\nGene Symbol: CCL28\nGene ID (NCBI): 56477\nRRID: AB_2262251\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868963557545,"sku":"18214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18214-1-ap","provider":"Iright","version":"1.0","type":"link"}