{"product_id":"proteintech-18283-1-ap","title":"Proteintech, 18283-1-AP, CD93 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD93 (18283-1-AP) by Proteintech is a Polyclonal antibody targeting CD93 in IHC, ELISA applications with reactivity to human samples\n18283-1-AP targets CD93 in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD93, also known as C1qR or C1qR(p), is a single-pass type I transmembrane glycoprotein and a member of the group 14 of the C-type lectin-like domain (CTLD) superfamily, which also includes endosialin\/CD248, thrombomodulin, and CLEC14A (PMID: 31287944). CD93 consists of a C-type lectin-like domain, five EGF-like repeats, a mucin-like domain, a transmembrane domain and a cytoplasmic domain (PMID: 28912033). CD93 is mainly expressed on endothelial cells and has been reported to be expressed by neurons and various cells of the hematopoietic system, including monocytes, neutrophils, B cells, natural killer cells, platelets and hematopoietic stem cells (PMID: 37443812). CD93 plays a role in various physiological processes including angiogenesis, inflammation, and cell adhesion (PMID: 31287944).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13132 Product name: Recombinant human CD93 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-572 aa of BC028075 Sequence: WGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQN Predict reactive species\nFull Name: CD93 molecule\nCalculated Molecular Weight: 69 kDa\nGenBank Accession Number: BC028075\nGene Symbol: CD93\nGene ID (NCBI): 22918\nRRID: AB_2878528\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPY3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869653717161,"sku":"18283-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18283-1-ap","provider":"Iright","version":"1.0","type":"link"}