{"product_id":"proteintech-18331-1-ap","title":"Proteintech, 18331-1-AP, AP3B2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP3B2 (18331-1-AP) by Proteintech is a Polyclonal antibody targeting AP3B2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n18331-1-AP targets AP3B2 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP3B2 is a subunit of the AP-3 complex which is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2). AP-3 complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12861 Product name: Recombinant human AP3B2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 650-1082 aa of BC093739 Sequence: DPSVRNVEVPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDNEDQDEDEEKGRGSESEQSEEDGKRKTKKKVPERKGEASSSDEGSDSSSSSSESEMTSESEEEQLEPASWSRKTPPSSKSAPATKEISLLDLEDFTPPSVQPVSPPAIVSTSLAADLEGLTLTDSTLVPSLLSPVSGVGRQELLHRVAGEGLAVDYTFSRQPFSGDPHMVSVHIHFSNSSDTPIKGLHVGTPKLPAGISIQEFPEIESLAPGESATAVMGINFCDSTQAANFQLCTQTRQFYVSIQPPVGELMAPVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQALTQ Predict reactive species\nFull Name: adaptor-related protein complex 3, beta 2 subunit\nCalculated Molecular Weight: 1082 aa, 119 kDa\nObserved Molecular Weight: 120-140 kDa\nGenBank Accession Number: BC093739\nGene Symbol: AP3B2\nGene ID (NCBI): 8120\nRRID: AB_2878531\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13367\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869514748073,"sku":"18331-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18331-1-ap","provider":"Iright","version":"1.0","type":"link"}