{"product_id":"proteintech-18338-1-ap","title":"Proteintech, 18338-1-AP, Plakophilin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Plakophilin 3 (18338-1-AP) by Proteintech is a Polyclonal antibody targeting Plakophilin 3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18338-1-AP targets Plakophilin 3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  A549 cells,  HeLa cells,  MCF-7 cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human skin tissue, human bowen disease,  human colon tissue,  mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13062 Product name: Recombinant human PKP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 170-400 aa of BC000081 Sequence: VGSRADYDTLSLRSLRLGPGGLDDRYSLVSEQLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALV Predict reactive species\nFull Name: plakophilin 3\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 87 kDa\nGenBank Accession Number: BC000081\nGene Symbol: Plakophilin 3\nGene ID (NCBI): 11187\nRRID: AB_2164281\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y446\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869486796969,"sku":"18338-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18338-1-ap","provider":"Iright","version":"1.0","type":"link"}