{"product_id":"proteintech-18346-1-ap","title":"Proteintech, 18346-1-AP, p35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe p35 (18346-1-AP) by Proteintech is a Polyclonal antibody targeting p35 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n18346-1-AP targets p35 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine\/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine\/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form (PMID: 10830966).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13152 Product name: Recombinant human CDK5R1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-307 aa of BC020580 Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR Predict reactive species\nFull Name: cyclin-dependent kinase 5, regulatory subunit 1 (p35)\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC020580\nGene Symbol: CDK5R1\nGene ID (NCBI): 8851\nRRID: AB_2878535\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15078\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869479489705,"sku":"18346-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18346-1-ap","provider":"Iright","version":"1.0","type":"link"}