{"product_id":"proteintech-18388-1-ap","title":"Proteintech, 18388-1-AP, SLC6A14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC6A14 (18388-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A14 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n18388-1-AP targets SLC6A14 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSodium- and chloride-dependent neutral and basic amino acid transporter B(0+) (SLC6A14) is a member of the Na+- and Cl−-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na+- and Cl−-dependent manner.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12857 Product name: Recombinant human SLC6A14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 138-264 aa of BC093710 Sequence: YSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKV Predict reactive species\nFull Name: solute carrier family 6 (amino acid transporter), member 14\nCalculated Molecular Weight: 642 aa, 72 kDa\nGenBank Accession Number: BC093710\nGene Symbol: SLC6A14\nGene ID (NCBI): 11254\nRRID: AB_3085563\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UN76\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869766635689,"sku":"18388-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18388-1-ap","provider":"Iright","version":"1.0","type":"link"}