{"product_id":"proteintech-18395-1-ap","title":"Proteintech, 18395-1-AP, SLN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLN (18395-1-AP) by Proteintech is a Polyclonal antibody targeting SLN in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n18395-1-AP targets SLN in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLN, also named as Sarcolipin, belongs to the sarcolipin family. It is associated with calcium ATPase SERCA1. It inhibits SERCA pumps. SLN, a key regulator of cardiac sarco(endo)plasmic reticulum (SR) Ca(2+) ATPase, is predominantly expressed in atria and mediates β-adrenergic responses. SLN can self-assembly to dimer and oligomer for playing importantphysiological function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat, squirrel\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13176 Product name: Recombinant human SLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-31 aa of BC005261 Sequence: MGINTRELFLNFTIVLITVILMWLLVRSYQY Predict reactive species\nFull Name: sarcolipin\nCalculated Molecular Weight: 31 aa, 4 kDa\nGenBank Accession Number: BC005261\nGene Symbol: SLN\nGene ID (NCBI): 6588\nRRID: AB_2286622\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00631\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914733225,"sku":"18395-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18395-1-ap","provider":"Iright","version":"1.0","type":"link"}