{"product_id":"proteintech-18790-1-ap","title":"Proteintech, 18790-1-AP, GNMT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNMT (18790-1-AP) by Proteintech is a Polyclonal antibody targeting GNMT in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18790-1-AP targets GNMT in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, mouse liver tissue,  LNCaP cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human prostate hyperplasia tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlycine N-methyltransferase (GNMT, EC 2.1.1.20) was found originally as an enzyme regulating the ratio of SAM to S-adenosyl- homocysteine. GNMT is conservative among different animal species. Glycine-N methyltransferase (GNMT) is a potential tumor suppressor that is commonly inactivated in human hepatoma. GNMT is abundant in liver, but very low in HepG2 cells (PMID: 12566990).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4598 Product name: Recombinant human GNMT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-295 aa of BC032627 Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD Predict reactive species\nFull Name: glycine N-methyltransferase\nCalculated Molecular Weight: 295 aa, 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC032627\nGene Symbol: GNMT\nGene ID (NCBI): 27232\nRRID: AB_10597093\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14749\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868860338345,"sku":"18790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18790-1-ap","provider":"Iright","version":"1.0","type":"link"}