{"product_id":"proteintech-18896-1-ap","title":"Proteintech, 18896-1-AP, B-Myb Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe B-Myb (18896-1-AP) by Proteintech is a Polyclonal antibody targeting B-Myb in WB, IP, IHC, ELISA applications with reactivity to human samples\n18896-1-AP targets B-Myb in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYBL2, also named as BMYB, is a 700 amino acid protein, which is phosphorylated by cyclin A\/CDK2 during S-phase. MYBL2 is a transcription factor involved in the regulation of cell survival, proliferation, and differentiation. The calculated molecular weight of MYBL2 is 79 kDa, but modified MYBL2 is about 90 kDa (PMID: 11418655).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13525 Product name: Recombinant human MYBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 401-700 aa of BC007585 Sequence: SGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS Predict reactive species\nFull Name: v-myb myeloblastosis viral oncogene homolog (avian)-like 2\nCalculated Molecular Weight: 79 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC007585\nGene Symbol: B Myb\nGene ID (NCBI): 4605\nRRID: AB_10644283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10244\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881113257,"sku":"18896-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18896-1-ap","provider":"Iright","version":"1.0","type":"link"}