{"product_id":"proteintech-18971-1-ap","title":"Proteintech, 18971-1-AP, TULP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TULP1 (18971-1-AP) by Proteintech is a Polyclonal antibody targeting TULP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18971-1-AP targets TULP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells, human brain tissue,  mouse retina tissue\nPositive IHC detected in: human eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTULP1, also known as RP14, LCA15, and TUBL1, is a member of the tubby-like protein (TULP) family. TULP1 is expressed exclusively in the retina and is essential for the transport of rhodopsin from its site of synthesis in the inner segments through the connecting cilium to the outer segments(PMID: 17620573). Mutations in TULP1 are associated with Retinitis pigmentosa 14 and Leber congenital amaurosis-15(PMID: 17620573, 17962469).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5598 Product name: Recombinant human TULP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-489 aa of BC032714 Sequence: TKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKNSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAPQGRTVRCRLTRDKKGMDRGMYPSYFLHLDTEKKVFLLAGRKRKRSKTANYLISIDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIYETNVLGFRGPRRMTVIIPGMSAENERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPVWNDDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE Predict reactive species\nFull Name: tubby like protein 1\nCalculated Molecular Weight: 489 aa, 55 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC032714\nGene Symbol: TULP1\nGene ID (NCBI): 7287\nRRID: AB_2211412\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00294\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869783216297,"sku":"18971-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18971-1-ap","provider":"Iright","version":"1.0","type":"link"}