{"product_id":"proteintech-18972-1-ap","title":"Proteintech, 18972-1-AP, PAOX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAOX (18972-1-AP) by Proteintech is a Polyclonal antibody targeting PAOX in WB, IHC, ELISA applications with reactivity to human, mouse samples\n18972-1-AP targets PAOX in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, human stomach tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAOX, also known as PAO, belongs to the flavin monoamine oxidase family. PAOX is a FAD-dependent amine oxidase, which is constitutively expressed in nearly all tissues of the vertebrate organism. PAOX catalyzes the oxidation of N1-acetylspermine to spermidine and thus involved in the polyamine back-conversion. PAOX can also oxidize N1-acetylspermidine to putrescine. PAOX has 4 isoforms with the molecular weights of 7, 35, 52 and 56 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5777 Product name: Recombinant human PAOX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-364 aa of BC032778 Sequence: RLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPELQDAWFRKL Predict reactive species\nFull Name: polyamine oxidase (exo-N4-amino)\nCalculated Molecular Weight: 511 aa, 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC032778\nGene Symbol: PAOX\nGene ID (NCBI): 196743\nRRID: AB_2159196\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6QHF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971487401,"sku":"18972-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-18972-1-ap","provider":"Iright","version":"1.0","type":"link"}