{"product_id":"proteintech-19003-1-ap","title":"Proteintech, 19003-1-AP, VEGFA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VEGFA (19003-1-AP) by Proteintech is a Polyclonal antibody targeting VEGFA in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n19003-1-AP targets VEGFA in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, bEnd.3 cells,  C6 cells,  Jurkat cells,  MCF-7 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human lung cancer tissue, human liver cancer tissue,  mouse kidney tissue,  mouse liver tissue,  mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells,  NIH\/3T3 cells\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVEGFA, also named VEGF or VPF, belongs to the PDGF\/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1\/VEGFR1 and KDR\/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ). This antibody can recognize all VEGFA isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, rabbit, monkey, bovine, sheep, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13500 Product name: Recombinant human VEGFA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC065522 Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR Predict reactive species\nFull Name: vascular endothelial growth factor A\nCalculated Molecular Weight: 412 aa, 46 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC065522\nGene Symbol: VEGFA\nGene ID (NCBI): 7422\nRRID: AB_2212657\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15692\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887955890345,"sku":"19003-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19003-1-ap","provider":"Iright","version":"1.0","type":"link"}