{"product_id":"proteintech-19028-1-ap","title":"Proteintech, 19028-1-AP, KLC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLC1 (19028-1-AP) by Proteintech is a Polyclonal antibody targeting KLC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n19028-1-AP targets KLC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, COLO 320 cells,  HepG2 cells,  mouse brain tissue,  SK-N-SH cells\nPositive IHC detected in: rat brain tissue, human bowen disease tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. Kinesin is tetrameric proteins containing two heavy (alpha) chains and two light (beta) chains. The alpha chains provide the tubulin binding site and the ATPase domains, whereas the beta chains are responsible for the specific attachment of the organelle to be moved by the kinesin tetramer (PubMed:21385839).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13570 Product name: Recombinant human KLC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-290 aa of BC008881 Sequence: MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLG Predict reactive species\nFull Name: kinesin light chain 1\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 61-70 kDa\nGenBank Accession Number: BC008881\nGene Symbol: KLC1\nGene ID (NCBI): 3831\nRRID: AB_10641041\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07866\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869553676457,"sku":"19028-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19028-1-ap","provider":"Iright","version":"1.0","type":"link"}