{"product_id":"proteintech-19068-1-ap","title":"Proteintech, 19068-1-AP, CD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD4 (19068-1-AP) by Proteintech is a Polyclonal antibody targeting CD4 in WB, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n19068-1-AP targets CD4 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, pig thymus tissue,  mouse thymus tissue\nPositive IP detected in: mouse thymus tissue\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells. CD4 is an accessory protein for MHC class-II antigen\/T-cell receptor interaction. It plays an important role in T helper cell development and activation. CD4 serves as a receptor for the human immunodeficiency virus (HIV).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13616 Product name: Recombinant human CD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 419-458 aa of BC025782 Sequence: CVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI Predict reactive species\nFull Name: CD4 molecule\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC025782\nGene Symbol: CD4\nGene ID (NCBI): 920\nENSEMBL Gene ID: ENSG00000010610\nRRID: AB_10603357\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01730\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852441257,"sku":"19068-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19068-1-ap","provider":"Iright","version":"1.0","type":"link"}