{"product_id":"proteintech-19070-1-ap","title":"Proteintech, 19070-1-AP, CREBZF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CREBZF (19070-1-AP) by Proteintech is a Polyclonal antibody targeting CREBZF in WB, ELISA applications with reactivity to mouse samples\n19070-1-AP targets CREBZF in WB, IF, IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue,  mouse ovary tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCREBZF is a basic region-leucine zipper (bZIP) transcription factor that belongs to the cAMP-response-element-binding protein (CREB)\/activating transcription factor (ATF) family. CREBZF gene expression produces two isoforms, CREBZF-L (long isoform of CREBZF, also known as SMILE) and CREBZF-S (short isoform of CREBZF, also known as Zhangfei), resulting from alternative initiation codons. CREBZF fulfills its role in transcriptional regulation by heterodimerizing with other transcription factors as a coregulator and then binding to target promoters and regulating downstream gene expression. CREBZF has been identified as a novel transcriptional coregulator of a variety of nuclear receptors (PMID: 31124138).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13625 Product name: Recombinant human CREBZF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-301 aa of BC093796 Sequence: GLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM Predict reactive species\nFull Name: CREB\/ATF bZIP transcription factor\nCalculated Molecular Weight: 272 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC093796\nGene Symbol: CREBZF\nGene ID (NCBI): 58487\nRRID: AB_10641036\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NS37\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869662597289,"sku":"19070-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19070-1-ap","provider":"Iright","version":"1.0","type":"link"}