{"product_id":"proteintech-19140-1-ap","title":"Proteintech, 19140-1-AP, VPS11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS11 (19140-1-AP) by Proteintech is a Polyclonal antibody targeting VPS11 in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n19140-1-AP targets VPS11 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human brain tissue,  mouse pancreas tissue,  mouse brain tissue,  human kidney tissue,  human heart tissue,  HeLa cells,  K-562 cells,  rat brain tissue\nPositive IP detected in: HEK-293 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVesicle-mediated protein sorting plays an important role in segregating intracellular molecules into distinct organelles. In yeast, Vps proteins are involved in the trafficking of endocytic and biosynthetic proteins to the vacuole, which functionally resembles the lysosome of higher organisms. VPS11 is the human homolog of the yeast class C Vps11 protein, a subunit of the HOPS (homotypic fusion and protein transport) complex. Mammalian Vps11 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and membrane docking\/fusion reactions of late endosomes\/lysosomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6227 Product name: Recombinant human VPS11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 689-941 aa of BC065563 Sequence: FQQIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFARKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT Predict reactive species\nFull Name: vacuolar protein sorting 11 homolog (S. cerevisiae)\nCalculated Molecular Weight: 108 kDa\nObserved Molecular Weight: 108-112 kDa\nGenBank Accession Number: BC065563\nGene Symbol: VPS11\nGene ID (NCBI): 55823\nRRID: AB_10642572\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H270\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868946419881,"sku":"19140-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19140-1-ap","provider":"Iright","version":"1.0","type":"link"}