{"product_id":"proteintech-19142-1-ap","title":"Proteintech, 19142-1-AP, GDF8\/Myostatin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDF8\/Myostatin (19142-1-AP) by Proteintech is a Polyclonal antibody targeting GDF8\/Myostatin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n19142-1-AP targets GDF8\/Myostatin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, mouse liver tissue,  PC-3 cells,  mouse heart tissue\nPositive IHC detected in: human heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyostatin, also known as GDF-8, is a member of the TGF-beta superfamily. Myostatin is expressed in the myotome and developing skeletal muscles. Myostatin negatively regulates skeletal muscle growth and development through the regulation of anabolic and catabolic pathways in skeletal muscles. Myostatin immunoreactive bands could be identified at ∼50, 32-35, and 16 kDa, which correspond to the precursor, glycosylated dimmer, and monomer, respectively (PMID: 17711997). GDF8 may have cross-reactions with GDF11.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, zebrafish, bovine, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13605 Product name: Recombinant human MSTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-375 aa of BC074757 Sequence: LNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Predict reactive species\nFull Name: myostatin\nCalculated Molecular Weight: 375 aa, 43 kDa\nObserved Molecular Weight: 50 and 35 kDa\nGenBank Accession Number: BC074757\nGene Symbol: MSTN\nGene ID (NCBI): 2660\nRRID: AB_10638615\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14793\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868847722665,"sku":"19142-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19142-1-ap","provider":"Iright","version":"1.0","type":"link"}