{"product_id":"proteintech-19279-1-ap","title":"Proteintech, 19279-1-AP, OAS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OAS2 (19279-1-AP) by Proteintech is a Polyclonal antibody targeting OAS2 in WB, IHC, IP, ELISA applications with reactivity to human samples\n19279-1-AP targets OAS2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IFN alpha treated A549 cells, Daudi cells,  Jurkat cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon  cancer, human breast cancer tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS2, are IFN-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS2 is also named as p69 OAS \/ p71 OAS. It has 3 isoforms(71\/69\/20 kDa) produced by alternative splicing. The OAS2 isozymes are 69-71 kDa and form dimers(PMID:17765707). Glycosylation is essential for its activity(PMID:9880569). Constitutive expression of the 69-kDa form of the OAS2 protein in human cells inhibited the replication of encephalomyocarditis virus (EMCV) but not that of VSV, Sendai virus, or reovirus(PMID:16501108). This antibody is specific to isoform p71 and isoform p69 of OAS2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6170 Product name: Recombinant human OAS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 335-687 aa of BC049215 Sequence: VLPAPLFTTPGHLLDKFIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVTQYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGNPIPPWKVPVKVI Predict reactive species\nFull Name: 2'-5'-oligoadenylate synthetase 2, 69\/71kDa\nCalculated Molecular Weight: 82 kDa\nObserved Molecular Weight: 66-71 kDa\nGenBank Accession Number: BC049215\nGene Symbol: OAS2\nGene ID (NCBI): 4939\nRRID: AB_10642832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P29728\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868868137129,"sku":"19279-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19279-1-ap","provider":"Iright","version":"1.0","type":"link"}