{"product_id":"proteintech-19570-1-ap","title":"Proteintech, 19570-1-AP, FAM32A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM32A (19570-1-AP) by Proteintech is a Polyclonal antibody targeting FAM32A in WB, IF\/ICC, ELISA applications with reactivity to human samples\n19570-1-AP targets FAM32A in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM32A (family with sequence similarity 32 member)  is also known as ovarian tumor associated gene-12 (OTAG-12, OTAG12) and its expression is suppressed in ovarian cancer. FAM32A is involved in increased cell proliferation and suppresses apoptosis (PMID: 21339736). FAM32A protein is a 13 kDa protein that consists of 112 amino acids and is predominantly located in the nucleus (PMID: 39730183).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13761 Product name: Recombinant human FAM32A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000639 Sequence: MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK Predict reactive species\nFull Name: family with sequence similarity 32, member A\nCalculated Molecular Weight: 112 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC000639\nGene Symbol: FAM32A\nGene ID (NCBI): 26017\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y421\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887632699561,"sku":"19570-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19570-1-ap","provider":"Iright","version":"1.0","type":"link"}