{"product_id":"proteintech-19598-1-ap","title":"Proteintech, 19598-1-AP, TRAPPC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAPPC1 (19598-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPPC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n19598-1-AP targets TRAPPC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRAPPC1, also known as BET5 or MUM2, is a part of the multisubunit TRAPP (transport protein particle) complexes which are involved in the tethering process at different trafficking steps of vesicle transport (PMID: 16828797). TRAPPC1 may play a role in vesicular transport from the endoplasmic reticulum to Golgi (PMID: 10582700).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5608 Product name: Recombinant human TRAPPC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-145 aa of BC032717 Sequence: MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG Predict reactive species\nFull Name: trafficking protein particle complex 1\nCalculated Molecular Weight: 145 aa, 17 kDa\nObserved Molecular Weight: 15-17 kDa\nGenBank Accession Number: BC032717\nGene Symbol: TRAPPC1\nGene ID (NCBI): 58485\nRRID: AB_3085582\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5R8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887837171881,"sku":"19598-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19598-1-ap","provider":"Iright","version":"1.0","type":"link"}